PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010536380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family SRS
Protein Properties Length: 367aa    MW: 39969.5 Da    PI: 7.0548
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010536380.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702232.47.7e-721232882154
          DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrel..............kskk 82 
                     r+g+++CqdCGnqakkdCah+RCRtCCksrgf+C+thvkstWvpaakrrerq+qlaa+++++  s + +++kr +e               +   
  XP_010536380.1 123 RQGGMNCQDCGNQAKKDCAHMRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQAQLAALQHQQGGSCRGDNAKRLHEPsgeggdtddgkeldHGVG 217
                     7899*********************************************************9999966666655555555666666665556778 PP

          DUF702  83 qsalsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     +sal+ t++++a+s+  le+ ++P+evss+avfrcvrvss+dd++ee+aYqtav+igGh+fkGiLydqG+++
  XP_010536380.1 218 ASALAVTRVVNANSS-GLEIGHFPPEVSSPAVFRCVRVSSIDDEDEEYAYQTAVNIGGHIFKGILYDQGPDH 288
                     899999999999866.999999************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.7E-65126287IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.7E-27128170IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.6E-28238286IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MAGFFYLGGG RDHHNNKQDH NYHHHHHHQD KDQEDKSNYL YLYKDEIYNN NKGFELWPPQ  60
YFQEQQQHVS PANFYSLGMV PNGSGSSSNN NNNNNNINRC RSLYFNVVSD EPLGSSGGFT  120
VTRQGGMNCQ DCGNQAKKDC AHMRCRTCCK SRGFQCQTHV KSTWVPAAKR RERQAQLAAL  180
QHQQGGSCRG DNAKRLHEPS GEGGDTDDGK ELDHGVGASA LAVTRVVNAN SSGLEIGHFP  240
PEVSSPAVFR CVRVSSIDDE DEEYAYQTAV NIGGHIFKGI LYDQGPDHSH NGYNSSPKAT  300
AAANANAASG SSQHLNLLAS TANAVTTAVT AGNNNNNASS WLDSASLYPA PLNAFIAGTP  360
FFPPPRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010536380.10.0PREDICTED: protein SHI RELATED SEQUENCE 5
SwissprotQ9LQZ51e-147SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLD7KSQ41e-143D7KSQ4_ARALL; Putative uncharacterized protein
STRINGAT1G75520.11e-145(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.11e-110SHI-related sequence 5